PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN07791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 263aa    MW: 29376.1 Da    PI: 9.9455
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN07791.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.11.8e-35201222106
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskks 100
                 +g+kdrhsk++T++g+RdRRvRlsa++a++f+d+qd+LG+d++sk+++WL+++ak++i+ l++++  ++   ++e++++++++ ssg  a ++++++++
  KHN07791.1  20 TGRKDRHSKVYTSKGPRDRRVRLSAHTAIEFYDVQDRLGYDRPSKAVDWLIKKAKTSIDRLAELPPWHP--PTHEEEKQNDAAGSSGIIAIAQQQQQHE 116
                 79**************************************************************33333..3344444444444444333333344444 PP

         TCP 101 qksaas 106
                 q+s+++
  KHN07791.1 117 QQSESC 122
                 444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-3120116IPR005333Transcription factor, TCP
PROSITE profilePS5136931.8722280IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MRTGVGDIVQ VEGGHIVRST GRKDRHSKVY TSKGPRDRRV RLSAHTAIEF YDVQDRLGYD  60
RPSKAVDWLI KKAKTSIDRL AELPPWHPPT HEEEKQNDAA GSSGIIAIAQ QQQQHEQQSE  120
SCGYNFQLQR QLGPSVQPML TLTPSIFKPT TPQKILAYPS IASKTTLASF IGNHNRQVHI  180
KHLLQMNTKS EPFLLAQPQV GVHTQLTAIY RPRPQPVNQP SIFDSRFVSD GLADFCIPDR  240
IQGVEENHGV ASNRPSSSPS SIH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592452.11e-148PREDICTED: transcription factor TCP4-like
TrEMBLA0A0B2PEI10.0A0A0B2PEI1_GLYSO; Transcription factor TCP4
STRINGGLYMA06G43721.15e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116334105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.36e-49TCP family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]